#wowskinscience #organicfashwash #applecidervinegarfoamingfacewash #noparabenfacewash #nosulphatefacewash #nosiliconesfacewash #fullreviewofwowskinscienceapplecidervinegarfacewash #howtousefacewash #builtinbrushfacewash #benefitsofusingwowskinsciencefacewash
Hi, I am reviewing the new built-in brush Wow Skin Science Apple Cider Vinegar Face wash.
Do like, share and subscribe if it helps you.
For Deep Cleansing and Balancing Skin:
WOW Skin Science Apple Cider Vinegar Foaming Face Wash is skin clarifying and deep cleansing face wash enriched with pure certified apple cider vinegar, Aloe Vera extract, and hyaluronic acid. Its effective formulation helps in removing dirt, sweat, excess oil and makeup very thoroughly. It helps in restoring skin’s natural pH balance and controls excess sebum production. Hyaluronic acid improves skin’s moisture levels, while Pro Vitamin B5 helps strengthen skin’s lipid barrier.
Contains pure organic apple cider vinegar that offers multiple skin benefits.
Helps clarify and hydrate skin
Gentle enough for regular use for deep cleansing.
Suits all skin types. Contains no harmful parabens, suphates or mineral oil.
Your skin looks fabulously clean, smooth and glowing.
BENEFITS OF WOW SKIN SCIENCE APPLE CIDER VINEGAR FACE WASH :
Assists in clearing and refining skin
It cleanses the skin of impurities and helps maintain skin’s natural pH balance for a refined look.
Helps prevent skin inflammation
It helps soothe redness, dryness, and calm acne-prone skin.
Gives supple, bright complexion
Regular use ensures that your skin is squeaky clean and looks even toned and smooth.
One-stop cleanser
An effective foaming face wash that clears away dirt, pollution and makeup residue, that helps skin absorb moisturizers better.
FORMULATED TO DELIVER DEEPLY MOISTURISED, BALANCED, CLEAR SKIN
Restores skin’s normal pH
Organic apple cider vinegar helps remove excess sebum, clears dead skin cells for balanced skin.
Refines complexion and calms skin
Pro-Vitamin B5 helps minimize hyperpigmentation, dullness, and acne spots. Aloe extract helps soothe inflamed skin.
Offers deep hydration for supple skin
Hyaluronic acid helps skin draw and retain hydration for firm, supple, moisturized skin. Pro Vitamin helps strengthen skin’s lipid barrier to prevent moisture loss.
HOW TO USE
Splash some water on the face and neck. Take a coin size amount of the face wash in your palm. Rub your palms together to activate wash and create a lather. Massage the lather onto your face in circular motion focusing on your T Zone for up to 2 minutes. Wash it off thoroughly with plain water. Pat your skin dry. Use the face wash twice daily to keep your skin clear of dirt and pollution. Use lukewarm water to wash off, and finish off by splashing your face with cold water to close the pores and to prevent sebaceous gland under the skin from activating.
Category
Show more
Comments - 1
Related videos for 184 WOW Apple Cider Vinegar Foaming Face Wash with Built-In Brush | Full Review | How to use: